SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL086C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL086C
Domain Number 1 Region: 128-367
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.82e-29
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.029
Further Details:      
 
Domain Number 2 Region: 364-553
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000019
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YPL086C   Protein: S000006007
Sequence length 557
Comment ELP3 SGDID:S000006007, Chr XVI from 386443-384770, reverse complement, Verified ORF, "Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; exhibits histone acetyltransferase activity that is directed to histones H3 and H4; disruption confers resistance to K. lactis zymotoxin"
Sequence
MARHGKGPKTNKKKLAPEKERFIQCCADITLELTDSLTSGTTREINLNGLITKYSKKYKL
KQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMG
GTFMSLPKEYREDFIVKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCTQTH
LDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPN
VGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVAR
ILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTTCRDVRTREVGIQEV
HHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRNY
YGKLGYELDGPYMSKRI
Download sequence
Identical sequences A0A0L8VGK0 A0A250WDY2 A6ZWG5 B3LKY6 C7GVE6 C8ZIU4 E7M1F7 E7QAD9 G2WP95 N1NX70 Q02908
354945 YPL086C YPL086C YPL086C NP_015239.1.97178 YPL086c___KOG2535 YPL086C 4932.YPL086C YPL086C tr|A6ZWG5|A6ZWG5_YEAS7 YPL086C YPL086C YPL086C YPL086C YPL086C YPL086C YPL086C SCRT_02409 YPL086C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]