SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR086W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR086W
Domain Number 1 Region: 238-328
Classification Level Classification E-value
Superfamily Cyclin-like 2.6e-23
Family Transcription factor IIB (TFIIB), core domain 0.0017
Further Details:      
 
Domain Number 2 Region: 127-214
Classification Level Classification E-value
Superfamily Cyclin-like 4.46e-19
Family Transcription factor IIB (TFIIB), core domain 0.0023
Further Details:      
 
Domain Number 3 Region: 18-70
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000000619
Family Transcriptional factor domain 0.0025
Further Details:      
 
Domain Number 4 Region: 30-91
Classification Level Classification E-value
Superfamily PDB 0.0000129
Family PDB 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YPR086W   Protein: S000006290
Sequence length 345
Comment SUA7 SGDID:S000006290, Chr XVI from 710099-711136, Verified ORF, "Transcription factor TFIIB, a general transcription factor required for transcription initiation and start site selection by RNA polymerase II"
Sequence
MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTR
SEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMD
KKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGC
RRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIP
RFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQ
TLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK
Download sequence
Identical sequences N1NXN0 P29055
NP_015411.1.97178 YPR086W 4932.YPR086W YPR086W YPR086W YPR086W YPR086w___KOG1597 YPR086W 3k7a_M 4bbr_M 4bbs_M 4v1n_M 4v1o_M 5fmf_P 5fyw_M 5fz5_M 5oqj_M 5oqm_M 5sva_c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]