SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1r76A00/25-432 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1r76A00/25-432
Domain Number 1 Region: 10-406
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 1.46e-100
Family Family 10 polysaccharide lyase 0.00000000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cath|current|1r76A00/25-432
Sequence length 408
Sequence
avigmneaasaltpsrvsslpdtqraawqeylarseaqlsrdkaslaaelapgqplpppp
aegkgadtmpldkpaawytskaarhvadvivsfqtpaggwgknqprdgalrlpgqhytge
nvakvksgsndldaardrdwhyvgtidndatvteirflaqvvsqlapeeaapyrdaalkg
ieyllasqfpnggwpqvwpleggyhdaitynddalvhvaellsdiaagrdgfgfvppair
traleatnaaihcivetqvvqdgkrlgwgqqhdaltlrptsarnfepaalsstesarill
flmeieapsdavkqairggvawlntsvirdrawvksdqgyqlvteqgakplwsrfysldg
nkpvfgdrdktihddvmgisqerrtgyawyttspqkalsaftkwekrs
Download sequence
Identical sequences 1r76A cath|current|1r76A00/25-432 d1r76a_ 1r76_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]