SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for cath|current|1tv2A00/2-458 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cath|current|1tv2A00/2-458
Domain Number 1 Region: 2-458
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 5.78e-261
Family Monomethylamine methyltransferase MtmB 0.0000000000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cath|current|1tv2A00/2-458
Sequence length 458
Sequence
mtfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmme
klfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgd
kakpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaa
ktetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidl
daisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvh
irwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasg
reilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasap
agktfqecydvktvtpteeymqvydgarkkledlglvf
Download sequence
Identical sequences 1nthA 1tv2_A 1tv3_A 1tv4_A cath|current|1l2rA00/2-458 cath|current|1tv2A00/2-458 cath|current|1tv3A00/2-458 cath|current|1tv4A00/2-458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]