SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for d1ss3a_ from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  d1ss3a_
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Pollen allergen ole e 6 1.24e-27
Family Pollen allergen ole e 6 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) d1ss3a_
Sequence length 50
Comment g.2.3.1 (A:) Pollen allergen ole e 6 {Common olive (Olea europaea) [TaxId: 4146]}
Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Download sequence
Identical sequences O24172
1ss3_A 000008573|e1ss3A1|397.3.1.1|A:1-50 cath|current|1ss3A00/1-50 d1ss3a_ 1ss3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]