SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000231238 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000231238
Domain Number 1 Region: 115-244
Classification Level Classification E-value
Superfamily TPR-like 3.32e-29
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000231238
Sequence length 292
Comment (Homo sapiens)
Sequence
MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEE
ECFHDCSASFEEEPGADKVENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREESTRLK
EEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSK
AIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERN
ERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Download sequence
Identical sequences Q99614
ENSP00000231238 ENSP00000429225 HR6467 9606.ENSP00000231238 ENSP00000231238 NP_001269429.1.87134 NP_001269429.1.92137 NP_003305.1.87134 NP_003305.1.92137 gi|4507711|ref|NP_003305.1| ENSP00000231238 ENSP00000429225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]