SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006893 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006893
Domain Number 1 Region: 112-297
Classification Level Classification E-value
Superfamily Macro domain-like 3.03e-31
Family Macro domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Histone-fold 1.83e-16
Family Nucleosome core histones 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006893   Gene: ENSTNIG00000004264   Transcript: ENSTNIT00000007045
Sequence length 301
Comment pep:novel chromosome:TETRAODON8:Un_random:67880477:67882905:1 gene:ENSTNIG00000004264 transcript:ENSTNIT00000007045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEILEMAGNAARDKNKRRITPRHMKLAVANDDEPNQLLRGVTISSRGVLPRIHPELLSKK
RAGRGKAEGVAPPPQPAQQRPKSMKALRMVKGHRSTGGQAGATSAGDNGPRDGFTVQPAK
SLLLGPRLSLTESEVSRMGAIRAEAIVNPTDAHVLLDAAAGNALEKAGGGASWTALRSCA
KHTPPGGGGRVAVGQTSGMAAGFILHCHAPQWGWDQSEQQLERTVRNCLWASEDRPLTSV
AFPPLPAARNGFPRQTAAQLVLKAICSHFVSSSSSSLKNILLCDSESISVYLQEMAKLDA
N
Download sequence
Identical sequences H3CF69
ENSTNIP00000006893 ENSTNIP00000006893 99883.ENSTNIP00000006893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]