SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPU_025228 from Strongylocentrotus purpuratus v3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPU_025228
Domain Number 1 Region: 298-508
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.36e-51
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 148-298
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.45e-28
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 1-140
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.29e-27
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPU_025228
Sequence length 539
Sequence
MPYGNTIDKVRLTGRDLLKVLEVPMVTFDPSIPIYGFLQVSGMVIEYDLTRESGDRVHRA
QFRCMTCTDDGTNELMDVDPEGHYEVIMNSYMAGGGGGYDVVRENKMEHVSGNNDVDVTS
SFIKSTSPLNEEAEGRIILYDDVNRPSSESLVFNDVIPALQPRVNDLISVGINKIIALGH
AGFDVDQAVARDVKGVDIVVGGHSNTFLYTGEAPSNQVPVGDYPYIVHPAHDSEASVLVL
SAYAYGKYLGHLQVTFDENGTVTDYAGNPVLLDGSVEKDLATLAAVEAWEVRVDEISNEV
IGRTETRLDGDLATCGTQECNLGNVMADAMLFDHGMDWYGANIAMTTSGSIASSVEAGDI
TTGDLITIMPYGNTIDKVRLTGSDLLKVLEVPMVTFDPSIPIYGFLQVSGMVIEYDLTRE
SGDRVHRAQFRCMTCTDDGTNELMDVDPEGHYEVIMNSYMAGGGGGYDVVRENRMEHVSG
NNDVDVTSSYIKSNSPFNEEAEGRIILYDDVNRPSSGPTIRPIFGLLVILSLCALFQTY
Download sequence
Identical sequences W4ZAQ1
SPU_025228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]