SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TJE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TJE9
Domain Number 1 Region: 670-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000785
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 141-222
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000314
Family Cadherin 0.0067
Further Details:      
 
Domain Number 3 Region: 6-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000542
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091TJE9
Sequence length 737
Comment (tr|A0A091TJE9|A0A091TJE9_PHALP) Proto-oncogene tyrosine-protein kinase receptor Ret {ECO:0000313|EMBL:KFQ75052.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_06832 OC=Phaethon.
Sequence
AAFGLYFPRKEYSENVYIDQPAGTPLLRIHALRDSHGEVAHFHLCQNLIISRARSHENHW
FQIREKTGLLYLSKSLDREDFNMLSVGNWMPLSKVMLYVFLSSHPFQEKECDSAMRTTVF
LSLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLPSVHHLCQNLSISYKL
LAAEGMPFRYNENTTGVSVTQRLDREERERYELIAKCTVREGFREMQVGVPFLVNVLDED
DSPPFLPNGTDTADAVVEFNRKEGTVLATLTVYDADTTPIYPLESSRKKYTGTIITDDPW
ISETFRVEHIFDEIHFSPNGSQVRGTQHEYKLVLNKSISVTEHRSFQLDVLVNDTEFHGP
ERSVMLHFNVSILPVSIQFPNMTYQFTVNRNAERFAQIGKICIENCMKFRGVNITYKLLS
PNVSCYPVSILQGREDKYGSLYVNDSSVLRRPECKEIQYTIQATDKQSRKHTKTLLTVVL
EGTLLKKEEDCPDSCAVSKHHAECEECGGLGVLTGRCQWRQGSGKGITTNYSTCTPSIKT
CPDGTCDVIESKDPAVCPQDCTSGNIIGGHGKGIGNLGIKSGHGICYCFPRQNCYCEKDD
IKEQLCDDVCKTVIAGAVLLSFIISVLLSSYFIHRYHKNSPKPPIASAEMTFRRPAQSYP
ISYSSTNVRRPSLDSMENQVSVDTFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAF
RLKGRAGYTTVAVKMLK
Download sequence
Identical sequences A0A091TJE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]