SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S6VRM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S6VRM6
Domain Number 1 Region: 387-510
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000105
Family Heme-binding PAS domain 0.09
Further Details:      
 
Domain Number 2 Region: 320-367
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000405
Family HAMP domain 0.0047
Further Details:      
 
Domain Number 3 Region: 577-785
Classification Level Classification E-value
Superfamily PP2C-like 0.0000706
Family PP2C-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S6VRM6
Sequence length 788
Comment (tr|A0A0S6VRM6|A0A0S6VRM6_9BACT) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:GAK49888.1} KW=Complete proteome; Reference proteome OX=1499966 OS=Candidatus Moduliflexus flocculans. GN=U14_01112 OC=Bacteria.
Sequence
MLSFFRRLSIQWKLAFSFMALSLFPLFGLGSMAYFTSQATIRQKVGFYSQKNLEQICQNL
QGTLEQIEKLSRLIVLDGKMSERLATFSTQTTLQKLKRTRDIEAELSALAISHPDVRQIL
LARRHEPLLASKESLLEKEQNYFSTDDFWQSDLYQEIARLRGQVIWKSGIRGKYTEFYLL
RQLIDPNTAQELGILVFVIKPDLLNRVLIQQTQSDGSQMFVIEQSAKIVAHSQASLTGTS
VTQTYLPEIFRDSHAGYFQTETALVVFSPLSNQWHIIWEIPLTFLFEEINRVGMIIVLAV
VVCGALAVALGLAISSVYSRIIRELVDSASAIANGELDHPLQLSGEDEIGQLAKQFATMR
DAIRQKIEALQTLNSELDMRVEQRTLELSAANAELARGQYILNCFMDNVPDGIYFKDRDS
RFFRLNNSFAAKFGVNDPALLIGKCDFDFFSEEYARPKYEQEQEIIRTGQPLLAFEEPDF
NGRWALSTKMPLRDEYGEIVGTFGISRDITPLKTAQKQIEDAYAEIQILNEQLKQENLRM
SAELDVARRLQMMVLPKPQELTQIPDLDIVGYMQPADEVGGDYYDVLHCQQGRVCIGIGD
VTGHGLESGVLMLMTQTAIRTLIDRGEIDPVIFLGTLNRVLYQNIQRMGGDRSLTLSMVS
YQNGQIRIIGQHEEAIVVRQNGQIERLDTIDLGFPLGMVADIREWVTEVNVTLQSGDGVV
LYTDGITEAQNAHNQFYGLERLCAVISANWRGASAETVKEAIIADVRAFIGNAIVYDDVT
LVVLKQTA
Download sequence
Identical sequences A0A0S6VRM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]