SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C7PTF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C7PTF0
Domain Number 1 Region: 142-326
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.79e-26
Family Prokaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C7PTF0
Sequence length 356
Comment (tr|C7PTF0|C7PTF0_CHIPD) Serine protease {ECO:0000256|RuleBase:RU004296} KW=Complete proteome; Reference proteome OX=485918 OS=2034). GN=Cpin_3473 OC=Chitinophagaceae; Chitinophaga.
Sequence
MAGILDEQPYPWHKKTAQQLHLKLCQFSASVPGILLVAAQSQIEAYNLHTEETPYLLWAD
ILEYAAIHGHLRELITNIANRLSATSPIRSFFQDLLANQDPPLDAEPVGPLGAPRFISDT
DDITENEALLYKEDLTLRIVKVPALINTLQKLTTLAPGVCRFIVEVQGSTQYGTGFLIGK
DMLLTNWHVLHHETNGTKASAATAEFLFDDSHANSSVKIPCDVNTIVTSQEDDWAIIRST
QPLEDNWPIIALSKAVAPQNNIAAYIIQHPGGESKRVGFVRNQVSDFNDRVVHYLTDTQR
GSSGAPVFDENGNLFGLHHAGGRPQTIVGKPPLVKNEGILISKVVEGLKRYEVAFD
Download sequence
Identical sequences C7PTF0
WP_012791116.1.2976 485918.Cpin_3473 gi|256422488|ref|YP_003123141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]