SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8TPU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8TPU2
Domain Number 1 Region: 420-497
Classification Level Classification E-value
Superfamily SBT domain 3.79e-31
Family SBT domain 0.00015
Further Details:      
 
Domain Number 2 Region: 931-1031
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000058
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8TPU2
Sequence length 1199
Comment (tr|D8TPU2|D8TPU2_VOLCA) Uncharacterized protein {ECO:0000313|EMBL:EFJ50419.1} KW=Complete proteome; Reference proteome OX=3068 OS=Volvox carteri f. nagariensis. GN=VOLCADRAFT_58461 OC=Chlamydomonadales; Volvocaceae; Volvox.
Sequence
MDLANLFNDEGAGSERTNSITSSDLDPFLLQGDDQTWAVEDWNWDPFNMFAAPKETPNVA
CCQALKRRKVDNTAAAQGQPQQQAQQGACCQGPSGSIRAGGQPPAAAAACCSFTPNQTQA
MQQLTGPLQAAMNSLAPQKAVVETCAVSSMCHGPGAMVPPAAVPAAASVAATGPQMLNVN
MGMALPAGMGWAGLGDMSSPAASAAAAAMAAAVDMPGFFTSMTGGTGRPLAGMGWGIQPM
ALQMPSMPMQPFPGSHAQCAPALSMPASGFPTPSGVFQQQASMALPPSSVPSPALGSSGE
TSSLQGSADNAKALCCSGNRGGGGPTCSGGRQQADSSNKASMPLPNKAHQTGATGGRGAD
GAMVGGDLSDFAISDSEDEDEVGRRGPLGNNRGNGAHHQQHQYLGDVIALHDVGDDNGLM
VCQVPGCGKDLSGLKEYHQRYRICDVHIKLQQVMKDGRLQRFCQQCGRFHELTAFDGNRK
SCRDQLSKHNARRRRRAQAEQAKGKSAAVDPFAVGAVGCGAAAAANGGATASFDGDVGKL
LTCLMQNPSQLHALRLLLGVPTHPALPASHPAPGLGLGVGLGSGSPADSSSDGSDQARTY
ALARDIMGARNEFAPAFESEHRLIRLSMKLFNRTPADLPSDLRNQVNSWLASAPAGMEAS
IRPGCVFLTVQMLVDEAGEAQAMAPGALGSLAQHLLTRTGCPFWHTGMYTLQLHEDIMLV
RDGRVSCDAASANGDGRFPVIRRLGPLAAVAGQPVTLKLHGQHLDAPNCLVIVRWGAQHL
KAHMQPLSAHRAIVRLPPLPELCGPVWVELMRGAYLSPAKQMLVARNEALVEEINKLDVR
YGPLSQETVELMLQDMAIVLQHIAGEQGAGAQLPHAAIALKARRLLAIACDMGWAAVASA
VLPLACARCSCASEMVAAIHAASVPSSASSASSSSGDKRGLTLLHRAVRSGSIPLLAGML
AWGDSHGYRWRVDAAGPAGITPLHLSAMLDDARVGLLLLDHCGWPAAFTHLKSDNGVTPF
HLAFQMGHYQVDSLMAILGGLHQIDQHAGANNAVGAGAQPAGRRSRCGANAAAMVMGCKA
EENEDVKPALRGHGHNNTATAAKNGCCAELDPCEMCHCTLPPLLLSIMASCNECGRRRMC
MEAECTGAADRCGGCCCGTARPTLRSDSGEVCSSRQHSTVFSITALCQGCHGNRILAVA
Download sequence
Identical sequences D8TPU2
XP_002948544.1.37214 jgi|Volca1|58461|e_gw1.10.148.1 Vocar20013714m|PACid:23136591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]