SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3WA34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3WA34
Domain Number 1 Region: 678-890
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-48
Family Protein kinases, catalytic subunit 0.0000061
Further Details:      
 
Domain Number 2 Region: 14-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.0061
Further Details:      
 
Domain Number 3 Region: 151-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000243
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G3WA34
Sequence length 894
Comment (tr|G3WA34|G3WA34_SARHA) Ret proto-oncogene {ECO:0000313|Ensembl:ENSSHAP00000012289} KW=Complete proteome; Reference proteome OX=9305 OS=Sarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius). GN=RET OC=Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sarcophilus.
Sequence
LTLPCFAKAVLGLYFSRDTYSEKLYIDEPVGTPLLYVHALQDARGEVPHFRLGQHLYSTY
RSQPHKNDWFQINEDTGLLYLNQSLDQRALEKLSARNGGFPLLTIYLQVFLSPKPLRESD
CHWPSCAKVMLSVINTTMPACSSLKPREFCFLETGLSFRIRENKPPGTFHQFRLLPVQHL
CPNISISYQLLGEEALPFYSDKDTMEVNMRHSLDREEKEKYELIAKCTVWEGLREEVVMV
PFPVTVYDEDDSPPNFPNGINTANAVVEYKRKEGTVLAVLQVFDADVVPSSVDIPRKYIH
TMLTSDPLVNEFFRVEHSPNETSYNSNGSRVRAMMHDYKLVLNRSLPITESHSFQLGVLV
NDTDYQGPGGVLHLYFNVTILPVSIRFPNISYSFSVNRNAHRYAQIGKVCIENCKEFHGV
NITYKLQSLSVNCTALGIITTPESTTGNLFVNDTSMLQRPECTGMKYLVIASDRQSKKQS
RTTSTISVEGNFFPEEEGCPISCAVNKRRSECEECGGLGTLMGTCQWRQGDGKGISKNYS
TCTPSLKTCPDGNCDAVESRDLHICPQDCIRGDIIGGHERGEWRGIKAGYGVCNCFPEKK
KCFCEPDDDKEPLCDEVCRMVIAVAVLFSFIFSVLLSSYFIRRYHKNSHKPPIASAEMTF
RRPAQAYPISYSSSNVRRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKTLGEGEFG
KVVKATAFRLKGKAGYTTVAVKMLKENASPSELKDLLSEFNLLKQVNHPHVIKLYGACSQ
DGPLYLIVEYAKYGSLRSFLRESRKVGPSYMGGNGNRNSSYLDNPDERALTMGDLISFAW
QISRGMHYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRSK
Download sequence
Identical sequences G3WA34
ENSSHAP00000012289 ENSSHAP00000012289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]