SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V9H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V9H8
Domain Number 1 Region: 701-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.83e-45
Family Protein kinases, catalytic subunit 0.00000506
Further Details:      
 
Domain Number 2 Region: 149-224
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000137
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 3-73
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000671
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2V9H8
Sequence length 1017
Comment (tr|H2V9H8|H2V9H8_TAKRU) Ret proto-oncogene receptor tyrosine kinase {ECO:0000313|Ensembl:ENSTRUP00000045868} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=ret OC=Takifugu.
Sequence
GLYFSQNEYIETVYVGQPAGTPVLQVHAMRDGDTERPHFYLCSMNSRRRPAHVSWFRLDI
STGVLSLNKTLEESDFASFCELYAGRDPSSQSVKKLSMHVMALPGFTKNSLCNSRSCPRI
NLEFVNATMPQCGQTDLKELCFPHKDTSNPHITENRFPGALRQLRRLSRFNVCPNYTISY
NVETETPAPFAVNETTAELVVTAMLDREESESYRLLLVCTVRTETVITKVETSLDVFVDD
EDDNAPYLNGTDTADIVISFNRTVGGSFGTLSVFDRDLTPIIGRSHNKYVGTLLNIDPWA
KETFDIKSSFRERKAQGGIRETVHDYYLVLKRNLNVMENRTLQLDYLVNDTTYPGLEGTV
LLHFNITILPVHIQFSNITHIFPLTRRASSYAQVGKVCVENCQQFDGFRVTYRLEVPDKN
ASADAQSCHAAVRIAQAPDEMWALLYVNDSEALCRPECQDLQYLVVVKEEHTQLETSTQI
QIILDNEAGQESQPLLSCAENRRRGDCESARGLGTTTGRCQWRQGYDKGISENYSTCSPD
LRTCPDRFCDAVESKDASICPQDCTSETIPNITIVIMATRAFLPCGLLAVVKEKPVIGGH
ERGLRNGIQAGHGTCYCYTEKCFCEKEDIKETICDDMCKTIIATALLLSFIISILLSSYF
IHRYHKNSPKPPIASAEMTFRRPAQAYPISFPANNLRRGSQESIETDTFKIPEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHSELRDLLSEFTLLK
QVNHPHVIKMYGACSQDGPLYLIVEYAKYGSLRNFLRESRKVGPSYMGRDANRNSSYWSF
GVLLWEIVMLGGNPYPGIAPERLFNLLKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPT
FSDISKELEKMMVKSRDYLDLAASTPADALLYDDALSEEDTPLVDCNNAPLPRTLPSTWI
ENKLYGMSYPNWPEKSPVPLNRHDATNPVFTRYANDSVYANWMALPSPAKAVDKLDS
Download sequence
Identical sequences H2V9H8
ENSTRUP00000045868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]