SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|508605422|ref|YP_006990988.2| from Carnobacterium maltaromaticum LMA28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|508605422|ref|YP_006990988.2|
Domain Number 1 Region: 696-979
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.27e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000834
Further Details:      
 
Domain Number 2 Region: 118-423
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.48e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 990-1200
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.18e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000548
Further Details:      
 
Domain Number 4 Region: 426-631
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-40
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|508605422|ref|YP_006990988.2|
Sequence length 1337
Comment LPXTG-motif cell wall anchor domain protein [Carnobacterium maltaromaticum LMA28]
Sequence
MKQKKHIQRHLFKSINVVAVLFLLFGGVAPAALAVESLNQTDANQEQVVLEENIEQTEMK
ADTETPVVESPVIEEPPEKASDVTKIEETSVPEEVAPVEKEQAPLTSEADPVPTAPEPEE
RKLTILGTTDVHGSLWDWSYEDSAPKDGGLAKISTIVNETRAIDPDTILVDAGDNIQGTL
LTDDLYNVKPELLAQTHPMIKAMNYMQYDSMSLGNHEFNFGLGLIEKIRNDANFPLLSAN
TYKKADGTNLVDAYKIKEVKGVKVGVLGLTIPHVPMWDGAKVESLEFRSLREEAKKQVRI
LKDVEQVDVIVAAIHAGLKNSDPEAAAENVIKEVPEIDAFVIGHDHKEVAQKMADYTGKE
KPVGAAKDTGTGVVKIELELNKPDTKWEVTGSSVEVLQTANKIADPAVKELTQDAHETVV
EFIQDPIGTAKADFLPEAEIPGIPEAQLQPTAMISLINNVQMKVTGADIAAGALFKANSH
LDAGPITFADVFDIYKYPNTLIGVEIKGDQLKRYMESQANYYNQYKKGDVTIGFNEKIRV
YNYDMFTGVNYKIDISKPTGSRIVDLTYQGKPVADSDTFKLAINNYRYEGLVLDGIITAE
PYYVSDPITLRSSIVDYIAEKGEIDPEVENGKNWEIIGADLEHPLRSYIIEQIKLGTNDQ
IKIVDSDTGRTPNVKTLNADELIAAGAIPDDVLASLEKLTIMHTNDMHGRMLPDSKNNAL
GLAKLKTYKKQVNPTLMVDSGDAFQGLPISNYSKGFDMAKAMNEVGYDAMTVGNHEFDFG
YDVAMQYKEKLNFPIVSANIYKDGVRSFDPYTIVEKNGKKYAIIGLTTPETATKTHPNNV
KGVTFKDPIPEAKAVLAELKGQADAYVFLTHLGIDETTPTQWRGDTLAKTLSEDPDFADA
NIVVLDGHSHSELPAGKQFGKVMLAQTGNHLNNVGLIEAKFSDPVAIKASLASASSLADL
EEDAAVKAIVDQAEANFKEGTSEVIMENNPYLLNGERDNVRARETNLGNLISDALSDYGQ
TGFANKSDFAVINGGGIRANIPAGKVTKGDVISVLPFGNIISQVAATGDQVYAMFEHSLR
SLPKMDEAGQVILDENGLPALGANGGFLQTSESIKVYYDSNKKGANPEASTAGERILRVK
ILNETTGKYEDLKRDKTYYVTTNDFLAAGGDGFTMLGGSREEGPSMDEIVIDYLREASQL
RLVRAAEKVVDLSKYAKELPGERIISMTEADFNKMEKPVEPGKPVEPGKPGEGNGGVGEE
GQGSGNGSGGTGTGSGNVGTNTGTNTGTGGSQATNGKKPTTNFPATGESEFSWFFSGFVL
IVVGGAASYVTRRKKVS
Download sequence
Identical sequences A0A0R2IC08 K8ED40
gi|508605422|ref|YP_006990988.2| WP_015075249.1.1647 WP_015075249.1.23174 WP_015075249.1.92980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]