SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005616 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005616
Domain Number 1 Region: 177-361
Classification Level Classification E-value
Superfamily Macro domain-like 1.68e-55
Family Macro domain 0.0000000351
Further Details:      
 
Domain Number 2 Region: 12-117
Classification Level Classification E-value
Superfamily Histone-fold 6.98e-38
Family Nucleosome core histones 0.00000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005616   Gene: ENSPFOG00000005617   Transcript: ENSPFOT00000005625
Sequence length 365
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520191.1:177651:192479:-1 gene:ENSPFOG00000005617 transcript:ENSPFOT00000005625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGGKKKTTKTSRSTKAGVIFPVGRMLRYIKRGLPKYRIGVGAPVYLAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAIANDEELNQLLKGVTIAAGGVLPNIHPELLAKKRGA
KGKLETPVSPAPEKKPKTVKKTAAKKLGGKKAGGKTKRGEVSKSASADSTTEGSLADSFT
VLSTKSLFLGQKLQVVQADISAVESDAVVHPTNSTLYSGGEVGSALEKKGGKEFTEALQE
LKKKNGPLEVAGALLTGGFGLPAKYVIHCNSPGWGSEKCEEMLEKTVKNCLALADEKKLK
SVAFPSIGSGRNGFPKQTAAQLILKAISSYFVATMSSTIKTVYFVLFDSESIGIYVQEMA
KLETS
Download sequence
Identical sequences A0A087XIL3
ENSPFOP00000005616 XP_007541082.1.10163 XP_014865775.1.96476 XP_014911407.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]