SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384457077|ref|YP_005669497.1| from Clostridium acetobutylicum EA 2018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384457077|ref|YP_005669497.1|
Domain Number 1 Region: 541-849
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.68e-77
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 34-332
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.15e-63
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 330-532
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.27e-49
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0002
Further Details:      
 
Domain Number 4 Region: 850-1080
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384457077|ref|YP_005669497.1|
Sequence length 1193
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [Clostridium acetobutylicum EA 2018]
Sequence
MSKQKKLNYLTARMLLIFFVIFTLLGNFPLRSFAASNDKTFDLVEINDFHGALEDTSNPA
NPVASVLGNRVKAVSASNPDTIVFGGGDLYQGSALSNILKGVPVQKVMDSLGMQFTTLGN
HEFDWGLDTLTNTTMQGANYNIICSNLYNKNPDGSKGSRVFDPYKIITKDGVRIAFIGGI
TNETPNIVTPSYVSDKIFTDLATEINSVASDIKNNNKADVIIAVVHEGEDNLDNIVSKLS
NVNAVFGGHTNTIEEKLVNNIPVINANCNGKGFADLKMTVAADGSVHFLNTTSSYIALDN
ANGYKSSNPTTDPDISSIVNDAKASVGPTLNQVLGNIKNTITRTQTSNPYGESALGNWAS
DVIKNYANADIGISNNGGLRTDLSSGDVTYGDIYALMPFDNDIETVTLNKAQLKDILEQA
VGNYQDSSYPNTTLGGKGLQVSGIKFTYDPSKSYGNKITSITRENETPINDTETLKLAGP
DFVLTGGDGFLRFNKSDIKSTLADTHKLVRDALMDNVKANNTVNYTMDNRIVNSATQIPS
TISILATSDIHGNVLNYDYATGKAPTNTQGLAKVSSYVNSVRASKPNVMLIDDGDTIQGT
PLSYYYDKIDTTSEYPLMKIMGAMKYDTWTLGNHEFNYGLPTLNRVISDARKENINVLSA
NTYNSDNTNFVNPYYIKTFNINGKTVNVGILGLTTKCIPDWEDPSHYAGLHFNDLVDEAK
LWVPRMKAAGANVVIVAAHSGEEGAADTIPENQIKAIATNVSGIDAIVAGHAHVTVNDTS
LKNPNGKTVPVVEPNKWGTFVSQIDITLDNSGNASTINTQNVKMTDSIPEDPNIVNIIQP
YQNKTLDYISTKLGTSTGEFTGSNQTTQPTAIMELINKVQKDAANAQLSIAAPLSSSAYI
PKGDVTIKDIMSVYVYENYLYGIKMTGKQLKDWLEYSVRYYKQVSSPNDSIAKDPALNVP
DYNLDQLYGATYDIDLTQPACTIDPSTGRIASGDRIKNLKINGVPIKDSDVFTVAINDYR
YNGGGGFMKAAGISNTDPSIVTYSSAKALGDDGQVRSLMQSYIKNNQTISPENSNNWKLY
TTPVSDTSTVPVAPTPIVNPLPTNNSTTSTGSNIPGEATTGAQPSSTTTSDAPNCQLSPN
SECQENTTSIKTLPKTGSMIDSTVLLIIGTLLLLLGLAFIIWNKFKNKQKSVQ
Download sequence
Identical sequences Q97M47
NP_346993.1.94244 WP_010963675.1.17575 WP_010963675.1.17905 WP_010963675.1.48544 WP_010963675.1.57811 WP_010963675.1.71350 WP_010963675.1.92914 gi|384457077|ref|YP_005669497.1| gi|337735566|ref|YP_004635013.1| 272562.CA_C0353 gi|15893644|ref|NP_346993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]