SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|345016814|ref|YP_004819167.1| from Thermoanaerobacter wiegelii Rt8.B1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345016814|ref|YP_004819167.1|
Domain Number 1 Region: 534-849
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.26e-78
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 33-341
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.81e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00047
Further Details:      
 
Domain Number 3 Region: 340-532
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.15e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000479
Further Details:      
 
Domain Number 4 Region: 850-1064
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.68e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345016814|ref|YP_004819167.1|
Sequence length 1226
Comment 5'-nucleotidase [Thermoanaerobacter wiegelii Rt8.B1]
Sequence
MFRSRSRILAIFVAAIMVFSMFFSAVPQIVFAATSKTFDFIEVTDFHGYLQNDGKLSDGT
IYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLKGQPVIDMMKNIGFDAI
TLGNHEYDWGINSVIDTQNATLKDSAIPVLAANVYDKTTGKPVSYVKPYVIIERDGVKIG
IIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQGVQIVVVLAHMGAYQDKSG
NATGNLIDFAKQVKGVDAIFGGHTHSIVTTRVNGIPVGVAYYYGRGFIDLKITLNDDGTV
TTGDMQYIDITGLYSTQNPVVDPEVQAIVDKAVQDVGPIFNEVIGQAAIDLTRTQSAEPY
GDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMKMTG
AQVKTILEQAVQDGGKGIQVAGLTFKYDPSKPSMQRVFDMRKSDGTPILMDKTYLVATNN
FMGTGGDGFKGFTDPDVAKTYVDTYKLVRDAFIDAVKAQKTVTSKIDNRIVPAKMSDATI
TVVATSDIHGNIYPWDYNTAKSANQGLAKVSTYVKQVRAQYPYVVLVDNGDTIQGTPLSY
YYDKIDTTTEYPLAKVMGAMKYDTWTLGNHEYNYGLDVLNRIINDMRNEGIHVLSANTYK
GDGTNFVDPYYIKTFDTPQGPVKVGILGLTTKTIPSWEDKDHYAGLHFNDLVEEANKWVP
KLREAGADIIIATIHSGEESPTDVIPENQVKAVATQVNGIDAIVAGHTHAIISQHTYKNP
AGETVIVTEPGKWGQYVSQINFNISKNADGKWVIDSKWSATIKMDDSVQADSDILNLAQP
YQDATLKYIGTKIGVATGDFLGTEQTVKETAIMDLINKVQKYYAKTDLSIAAPLSSSAKI
LKGDITIQDIMGVYVYENYLYGIKMTGKQLKDWLEWSARYYKQVSSPNDPITKDPTLNIP
DYNLDQLYGASYVIDLTQPAGHRIKNLKVNGKLVKDDDVFTVAINNYRFNGGGGFMQAAG
ITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTITPTVENYWYVSTTPVAEEAPSPVTQP
TPATTPQPQPAPQPVYNYGIVTASALNVRAGASTSSKIIGVLPAGKVVTLLEEVNGWYKI
DYNGKTGYIYGKYVAATPNPSNVTVLKAVKVTAKSGLNVRVGNSINAKKIGAVPYGTELK
VVGEYNGWYQIQYNGGFGYVYAKYTK
Download sequence
Identical sequences G2MUY2
WP_014062241.1.89705 gi|345016814|ref|YP_004819167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]