SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL066W-A from Saccharomyces cerevisiae 69_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: YIL066W-A   Gene: YIL066W-A   Transcript: YIL066W-A
Sequence length 147
Comment pep:known chromosome:EF4:IX:237366:237809:1 gene:YIL066W-A transcript:YIL066W-A gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQKQQYTISSNSRINLLGILVLNVVCGKSSIFFSHPQRLGKLGGSSLGSTGPFQTLSI
NFCIGCFLFNSNHFDLLFSLPSSSSILSMSVLEKFCSCIDSVTRCCPSQSLETPGSVASH
VVLALSSKCTPIQFNAKWSISHKSNTG
Download sequence
Identical sequences A0A023PXF8 C8ZAI1
YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A YIL066W-A 4932.YIL066W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]