SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018207 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018207
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily Histone-fold 1.59e-36
Family Nucleosome core histones 0.0000908
Further Details:      
 
Domain Number 2 Region: 155-258
Classification Level Classification E-value
Superfamily Macro domain-like 3.34e-26
Family Macro domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018207   Gene: ENSTGUG00000018162   Transcript: ENSTGUT00000019112
Sequence length 272
Comment pep:novel chromosome:taeGut3.2.4:6:2061871:2111888:1 gene:ENSTGUG00000018162 transcript:ENSTGUT00000019112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSGKKKMSKLSRSSRAGVIFPVGRMMRYLKKGTYKYRIGVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKGRIAPRHILLAVANDEELNQVLPMSSVETSSFDASVFPQGRSILKEK
VQDLFPKAVEMCVFCYTGCEAHAGEGSGCLSAIAASLSVCPNCGKALEKAGGKEFLETVK
ELRKSQGPLEVAEAALTQSSGLAAKFVIHCHIPQWGSDKCEEQLEETVKNCLTAAEDKKL
KSVAFPPFPSGSNCFQKSASSATNSRSTGGSF
Download sequence
Identical sequences H1A5P1
59729.ENSTGUP00000018207 ENSTGUP00000018207 ENSTGUP00000018207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]