SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g080670.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g080670.2.1
Domain Number 1 Region: 125-205
Classification Level Classification E-value
Superfamily SBT domain 2.35e-33
Family SBT domain 0.00000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g080670.2.1
Sequence length 760
Comment genomic_reference:SL2.40ch01 gene_region:72426066-72434691 transcript_region:SL2.40ch01:72426066..72434691+ go_terms:GO:0003700 functional_description:"Squamosa promoter binding protein-like 1 (AHRD V1 *-*- Q56YT3_ARATH); contains Interpro domain(s) IPR004333 Transcription factor, SBP-box "
Sequence
MISSLLSGDDPAASSNFDWSDLLDFDLHEQLNISFDDPLHQEQQPETEFVAPVIPSSEDS
PHSQDTDAGRIRKRDPRMACSNFLAGRIPCACPELDEKMEEEEMAGIGPGKKRARTVRAS
AGAGARCQVPDCEADISELKGYHKRHRVCLRCANATSVVLDGHSKRYCQQCGKFHILSDF
DEGKRSCRRKLERHNNRRRRKATDTSKTSAEKESQQLTTADDVSGDDDIVKDNTCMGSQL
GEKEILLESEGHVPICSTQGIQNNHSDSFTASGETQVDAEKENYKNSHSPSYYDNKSALS
SVCPTGRISFKLYDWNPAEFPRRLRHQIFQWLASMPVELEGYIRPGCTILTVFVAMPTFK
WGKLLEDPAAHLYELIASPGNMLRGRGSFLIYLNNMVFRVTKGENSVVKVKLKGPAPKLM
SIYPTCFEAGKPMEFFACGSNLMQPRFRFLVSFGGRYLGNDINVVPSDCKYEGDSSSTEH
QLLKIHVPRTEADLFGPAFVEVENESGLSNFIPILIAEKDICAEMKEIQRKFCSGGSECT
AVCSPCEASTSRKSEFSEFMLDVAWLLREPSSENVQILASVQMQRFNYLLNILMESQSTI
ILERVLSYFENIVKRNMLAGITDADMTLFQKNILEKNILLKERLHLKEYFAGDSGQIMQE
LPNLQDTAVPHKHNIEFGPTYWELTSRVPLLDAELPLRVKEQQSGKSCGFLVRKTLLTSR
TLVFVISGFALCLGLCATFLHPRKVGDIAMTIRRCLFDKT
Download sequence
Identical sequences K4AXW1
Solyc01g080670.2.1 Solyc01g080670.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]