SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc05g015510.2.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc05g015510.2.1
Domain Number 1 Region: 175-256
Classification Level Classification E-value
Superfamily SBT domain 2.09e-37
Family SBT domain 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc05g015510.2.1
Sequence length 463
Comment genomic_reference:SL2.40ch05 gene_region:10767268-10772201 transcript_region:SL2.40ch05:10767268..10772201- go_terms:GO:0003700 functional_description:"Squamosa promoter-binding-like protein 11 (AHRD V1 ***- B6TF72_MAIZE); contains Interpro domain(s) IPR004333 Transcription factor, SBP-box "
Sequence
MEWNVKWDWGNLVMFGSKASESPKELQLTDWGVEEEGELDGGSFNLSSGGSGTGGYGSDL
KCGSSIKSSISASTDSSPKDGFKVSNFAFETFNASPEDPSKKLESSKAEVSRNSPPMEAS
VGSVEPVIGLKIGKRTCETFGGGSSAKVSSFPPNPASSAAATKKAKSSTQNAPIPHCQVE
GCNLDLSSAKEYYRKHRVCDSHSKSPKVIVAGVARRFCQQCSRFHSVSEFDDKKRSCRRR
LSDHNARRRKPHQETIQFNSARLSSLFYDSRQPMNLVLNEAQLIHSRAAANATWESTQDS
KFSITREFTPKPERTGSTNGKSLLERNQFSRAVGAHSNASSLLLPSKGTTAEVFNRGAKE
SMFNMVTGPEFPRALSLLSTNSWGSSEPESVSLNHANQTSMPEQMMQAIPPHMSSQYWQA
GQHSSDPRYHTLAAANSNSGGSFQEMGVFKAPFDTDFYLNALN
Download sequence
Identical sequences K4BYR7
Sopim05g015510.0.1 Solyc05g015510.2.1 Solyc05g015510.2.1 XP_004239217.1.44838 XP_010321004.1.44838 XP_010321005.1.44838 XP_010321006.1.44838 XP_010321007.1.44838 XP_010321008.1.44838 XP_010321009.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]