SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc12g038520.1.1 from Solanum lycopersicum v.2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc12g038520.1.1
Domain Number 1 Region: 92-170
Classification Level Classification E-value
Superfamily SBT domain 1.15e-38
Family SBT domain 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc12g038520.1.1
Sequence length 447
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch12 gene_region:35933880-35935930 transcript_region:SL2.40ch12:35933880..35935930- go_terms:GO:0005634 functional_description:"Squamosa promoter binding protein 3 (AHRD V1 *-*- Q1MU26_PHYPA); contains Interpro domain(s) IPR004333 Transcription factor, SBP-box "
Sequence
MESWSYVSGGKGFVSEESVSVDDGITPCSWSQQGVKVGSQIRDAFGGEDESSSKHSSSSF
IDLKLGRGRFLDVKNFSLSSTKRNRAGGLNSFCQVQGCGKDLTSCKDYHKRHKVCEIHSK
TAKVIVNGIQQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPHTGLHSGRAGKHF
QPYSGTRFQGSSFVTSSFICQDILGGSLLHQPKHDMHDWYKNVKVEHCSDYSPELTMPFT
NKHSQPRPLFTSYHTDKHCPALHDEGITTITRSKNNESSNSYLNDIGGSDFVSRSLFHST
SIGSDVLNVMDSDSPFQGISNSGCALSLLSSQSQDSSNYSSVVPPSAHHLITPRSYNHYN
MTQTSECFPEASPKGSTSTVSTIYNLSEVISAKGQLEHILRNNCGSLQGSDYVNTKNLLS
CEDGTTIDLLQLSSQLHQVEHQRRSMK
Download sequence
Identical sequences K4DEK1
Solyc12g038520.1.1 Sopim12g038520.0.1 Solyc12g038520.1.1 XP_004252249.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]